PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G20770.1
Common NameAtEIN3, EIN3, MOE17.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family EIL
Protein Properties Length: 628aa    MW: 71421.4 Da    PI: 5.7649
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G20770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3500.96.4e-153494211353
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+m+lkrlke+ k     ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+Lr+WWk+k
  AT3G20770.1  49 DELERRMWRDKMRLKRLKEQDKG----KEG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDK 141
                  79*******************98....787.9****************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaai+kyqa+n+i++ +++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl+kdqg+ pyk
  AT3G20770.1 142 VRFDRNGPAAITKYQAENNIPGIHEGNNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQGPAPYK 238
                  **********************9999977.9******************************************************************* PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXXXXXXXX.XXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsceqkedve.gkkes 290
                  kphdlkkawkv+vLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++s    sl+ +s ++ +++ +++dve  +kes
  AT3G20770.1 239 KPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPESCpplSLSGGSCSLLMNDCSQYDVEgFEKES 336
                  *******************************************************************444579999****************656666 PP

                  X.XXXXXXXXXX.........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
         EIN3 291 kikhvqavktta.........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                  +  +v++ k ++                         + ++ rkrk +++ ++++  +  + tc++  + +se + +f d+ns+++++
  AT3G20770.1 337 H-YEVEELKPEKvmnssnfgmvakmhdfpvkeevpagNSEFMRKRKPNRDLNTIMDRT--VFTCENLGCAHSEISRGFLDRNSRDNHQ 421
                  6.7799999888999******************************9655556665544..7*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.8E-12949296No hitNo description
Gene3DG3DSA:1.10.3180.107.8E-75170306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-60175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010182Biological Processsugar mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MMFNEMGMCG NMDFFSSGSL GEVDFCPVPQ AEPDSIVEDD YTDDEIDVDE LERRMWRDKM  60
RLKRLKEQDK GKEGVDAAKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PENGKPVTGA SDNLREWWKD KVRFDRNGPA AITKYQAENN IPGIHEGNNP IGPTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGV PPPWWPNGKE DWWPQLGLPK DQGPAPYKKP  240
HDLKKAWKVG VLTAVIKHMF PDIAKIRKLV RQSKCLQDKM TAKESATWLA IINQEESLAR  300
ELYPESCPPL SLSGGSCSLL MNDCSQYDVE GFEKESHYEV EELKPEKVMN SSNFGMVAKM  360
HDFPVKEEVP AGNSEFMRKR KPNRDLNTIM DRTVFTCENL GCAHSEISRG FLDRNSRDNH  420
QLACPHRDSR LPYGAAPSRF HVNEVKPVVG FPQPRPVNSV AQPIDLTGIV PEDGQKMISE  480
LMSMYDRNVQ SNQTSMVMEN QSVSLLQPTV HNHQEHLQFP GNMVEGSFFE DLNIPNRANN  540
NNSSNNQTFF QGNNNNNNVF KFDTADHNNF EAAHNNNNNS SGNRFQLVFD STPFDMASFD  600
YRDDMSMPGV VGTMDGMQQK QQDVSIWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B2e-921743062134Protein ETHYLENE INSENSITIVE 3
4zds_A2e-921743062134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.248240.0flower| leaf| root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306859260.0
Genevisible257981_at0.0
Expression AtlasAT3G20770-
AtGenExpressAT3G20770-
ATTED-IIAT3G20770-
Functional Description ? help Back to Top
Source Description
TAIREncodes EIN3 (ethylene-insensitive3), a nuclear transcription factor that initiates downstream transcriptional cascades for ethylene responses.
UniProtProbable transcription factor acting as a positive regulator in the ethylene response pathway. Is required for ethylene responsiveness in adult plant tissues. Binds a primary ethylene response element present in the ETHYLENE-RESPONSE-FACTOR1 promoter with consequence to activate the transcription of this gene. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Function -- GeneRIF ? help Back to Top
  1. Transcription factor EIN3 is required for the second phase but not the first phase of growth inhibition by ethylene in Arabidopsis seedling hypocotyls.
    [PMID: 15466219]
  2. Light induced regulation of gene expression involves stabilization of EIN3 protein.
    [PMID: 17011517]
  3. Data show that through control of EIN3/EIL1 levels, EBF1 and EBF2 fine-tune ethylene responses by repressing signaling in the absence of hormone, dampening signaling at high concentrations, and promoting rapid recovery after ethylene levels dissipate.
    [PMID: 17307926]
  4. The bifurcate and antagonistic CTR1 and MKK9 pathways are both critical in determining ethylene-signalling specificity through two MAPK phosphorylation sites with opposite effects on EIN3 stability
    [PMID: 18273012]
  5. An ethylene signal elevates the levels of EIN3, which directly binds and activates the EBF2 gene promoter.
    [PMID: 18466304]
  6. A mutation in the EIN3 gene delayed the water-stress related increase in alpha-tocopherol and caused a reduction in the levels of this antioxidant by ca. 30% compared to the wild type.
    [PMID: 19258016]
  7. Data provide evidence that EIN3/EIL1 directly target SID2 to downregulate PAMP defenses.
    [PMID: 19717619]
  8. our studies demonstrate that ethylene similarly regulates EIN3 and EIL1, the two master transcription factors coordinating myriad ethylene responses, and clarify that EIN2 but not MKK9 is required for ethylene-induced EIN3/EIL1 stabilization
    [PMID: 20647342]
  9. EIN3/EIL1 physically interact with FIT, are required for full FIT accumulation, and contribute to full FIT downstream target gene expression.
    [PMID: 21586684]
  10. identify EIN3/EIL1 as a key integration node whose activation requires both jasmonate and ethylene signaling as a common mechanism to integrate diverse signaling pathways in the regulation of plant development and defense
    [PMID: 21737749]
  11. the transcriptional complex of EIN3-ESE1 is a crucial event in the salt response, thereby connecting the transcriptional regulation of EIN3 and the downstream protein ESE1 in the salt response.
    [PMID: 21832142]
  12. At moderate doses of salinity, partial insensitivity to ethylene might be compensated by changes in endogenous levels of other phytohormones and lipid peroxidation-derived signals in the ein3-1 mutant exposed to salt stress.
    [PMID: 22209220]
  13. Photo-oxidative stress may increase upon iron deficiency, which is prevented by expression of EIN3/EIL1.
    [PMID: 22212120]
  14. SR1 plays an important role in plant immunity and ethylene signaling by directly regulating NDR1 and EIN3.
    [PMID: 22345509]
  15. Ethylene via EIN3 concomitantly activates two contrasting pathways: the PIF3-dependent growth-promoting pathway and an ethylene response factor 1 (ERF1)-mediated growth-inhibiting pathway.
    [PMID: 22818915]
  16. Ethylene-promoting hypocotyl via IAA is mediated by light, and COP1 has a significant impact on the transcription of some genes downstream of EIN3. Thus, COP1 plays a crucial role in the opposite effects of ethylene on hypocotyl elongation.
    [PMID: 22890836]
  17. The signaling pathway involving EIN2-EIN3-miR164-NAC2 regulates leaf senescence and provides a mechanistic insight into how ethylene promotes the progression of leaf senescence in Arabidopsis thaliana.
    [PMID: 24064769]
  18. MYC2 interacts with EIN3 to attenuate the transcriptional activity of EIN3 and repress ET-enhanced apical hook curvature.
    [PMID: 24399301]
  19. YID1/MED16, together with MED25, regulate iron homeostasis by interacting with EIN3/EIL1 and regulating the expression of downstream genes.
    [PMID: 24456400]
  20. MYC2 physically interacts with EIN3 and inhibits its DNA binding activity
    [PMID: 24668749]
  21. High salinity induces EIN3 and EIL1 protein accumulation and activated EIN3 deters excess reactive oxygen species accumulation and increases salt tolerance.
    [PMID: 25330213]
  22. autophosphorylated BIK1 in the plasma membrane negatively regulates EIN3-dependent gene expression.
    [PMID: 26021844]
  23. EIN3, ORE1 and chlorophyll catabolic genes constitute a coherent feed-forward loop involving in the robust regulation of ethylene-mediated chlorophyll degradation during leaf senescence in Arabidopsis.
    [PMID: 26218222]
  24. these data suggest the detailed mechanism of DNA recognition by EIN3 and provide an in-depth view at molecular level for the transcriptional regulation mediated by EIN3.
    [PMID: 26352699]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G20770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT1G62380(A), AT1G74710(R), AT2G19590(A), AT2G25490(A), AT3G12500(A), AT3G23240(A), AT4G27440(A), AT5G25350(A), AT5G44420(A), AT5G47220(A), AT5G47230(A), AT5G54190(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, ethylene
Interaction ? help Back to Top
Source Intact With
BioGRIDAT4G17880, AT5G46760, AT1G32640
IntActSearch O24606
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G20770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256290.0AB025629.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOE17.
GenBankAF0042160.0AF004216.1 Arabidopsis thaliana ethylene-insensitive3 (EIN3) mRNA, complete cds.
GenBankAF0042170.0AF004217.1 Arabidopsis thaliana ethylene-insensitive3 (EIN3) gene, complete cds.
GenBankAY0698750.0AY069875.2 Arabidopsis thaliana AT3g20770/MOE17_6 mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188713.10.0protein ethylene insensitive 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLD7KZW30.0D7KZW3_ARALL; Ethylene-insensitive3
STRINGAT3G20770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Representative plantOGRP5631682
Publications ? help Back to Top
  1. Chang C,Shockey JA
    The ethylene-response pathway: signal perception to gene regulation.
    Curr. Opin. Plant Biol., 1999. 2(5): p. 352-8
    [PMID:10508761]
  2. Kosugi S,Ohashi Y
    Cloning and DNA-binding properties of a tobacco Ethylene-Insensitive3 (EIN3) homolog.
    Nucleic Acids Res., 2000. 28(4): p. 960-7
    [PMID:10648789]
  3. Stepanova AN,Ecker JR
    Ethylene signaling: from mutants to molecules.
    Curr. Opin. Plant Biol., 2000. 3(5): p. 353-60
    [PMID:11019801]
  4. Smalle J,Haegman M,Kurepa J,Straeten DV
    Ethylene can stimulate Arabidopsis hypocotyl elongation in the light.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(6): p. 2756-61
    [PMID:11038610]
  5. Trentmann SM
    ERN1, a novel ethylene-regulated nuclear protein of Arabidopsis.
    Plant Mol. Biol., 2000. 44(1): p. 11-25
    [PMID:11094976]
  6. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  7. Waki K,Shibuya K,Yoshioka T,Hashiba T,Satoh S
    Cloning of a cDNA encoding EIN3-like protein (DC-EIL1) and decrease in its mRNA level during senescence in carnation flower tissues.
    J. Exp. Bot., 2001. 52(355): p. 377-9
    [PMID:11283184]
  8. Tieman DM,Ciardi JA,Taylor MG,Klee HJ
    Members of the tomato LeEIL (EIN3-like) gene family are functionally redundant and regulate ethylene responses throughout plant development.
    Plant J., 2001. 26(1): p. 47-58
    [PMID:11359609]
  9. Wubben MJ,Su H,Rodermel SR,Baum TJ
    Susceptibility to the sugar beet cyst nematode is modulated by ethylene signal transduction in Arabidopsis thaliana.
    Mol. Plant Microbe Interact., 2001. 14(10): p. 1206-12
    [PMID:11605960]
  10. Wang KL,Li H,Ecker JR
    Ethylene biosynthesis and signaling networks.
    Plant Cell, 2002. 14 Suppl: p. S131-51
    [PMID:12045274]
  11. Lorenzo O,Piqueras R,Sánchez-Serrano JJ,Solano R
    ETHYLENE RESPONSE FACTOR1 integrates signals from ethylene and jasmonate pathways in plant defense.
    Plant Cell, 2003. 15(1): p. 165-78
    [PMID:12509529]
  12. Alonso JM, et al.
    Five components of the ethylene-response pathway identified in a screen for weak ethylene-insensitive mutants in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(5): p. 2992-7
    [PMID:12606727]
  13. Ouaked F,Rozhon W,Lecourieux D,Hirt H
    A MAPK pathway mediates ethylene signaling in plants.
    EMBO J., 2003. 22(6): p. 1282-8
    [PMID:12628921]
  14. León P,Sheen J
    Sugar and hormone connections.
    Trends Plant Sci., 2003. 8(3): p. 110-6
    [PMID:12663220]
  15. Hiratsu K,Matsui K,Koyama T,Ohme-Takagi M
    Dominant repression of target genes by chimeric repressors that include the EAR motif, a repression domain, in Arabidopsis.
    Plant J., 2003. 34(5): p. 733-9
    [PMID:12787253]
  16. Lee JH,Kim WT
    Molecular and biochemical characterization of VR-EILs encoding mung bean ETHYLENE INSENSITIVE3-LIKE proteins.
    Plant Physiol., 2003. 132(3): p. 1475-88
    [PMID:12857828]
  17. Rieu I,Mariani C,Weterings K
    Expression analysis of five tobacco EIN3 family members in relation to tissue-specific ethylene responses.
    J. Exp. Bot., 2003. 54(391): p. 2239-44
    [PMID:12909687]
  18. Yanagisawa S,Yoo SD,Sheen J
    Differential regulation of EIN3 stability by glucose and ethylene signalling in plants.
    Nature, 2003. 425(6957): p. 521-5
    [PMID:14523448]
  19. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  20. Ogawara T,Higashi K,Kamada H,Ezura H
    Ethylene advances the transition from vegetative growth to flowering in Arabidopsis thaliana.
    J. Plant Physiol., 2003. 160(11): p. 1335-40
    [PMID:14658386]
  21. Bohman S,Staal J,Thomma BP,Wang M,Dixelius C
    Characterisation of an Arabidopsis-Leptosphaeria maculans pathosystem: resistance partially requires camalexin biosynthesis and is independent of salicylic acid, ethylene and jasmonic acid signalling.
    Plant J., 2004. 37(1): p. 9-20
    [PMID:14675428]
  22. Guo H,Ecker JR
    Plant responses to ethylene gas are mediated by SCF(EBF1/EBF2)-dependent proteolysis of EIN3 transcription factor.
    Cell, 2003. 115(6): p. 667-77
    [PMID:14675532]
  23. Potuschak T, et al.
    EIN3-dependent regulation of plant ethylene hormone signaling by two arabidopsis F box proteins: EBF1 and EBF2.
    Cell, 2003. 115(6): p. 679-89
    [PMID:14675533]
  24. Guo H,Ecker JR
    The ethylene signaling pathway: new insights.
    Curr. Opin. Plant Biol., 2004. 7(1): p. 40-9
    [PMID:14732440]
  25. Brocard-Gifford I,Lynch TJ,Garcia ME,Malhotra B,Finkelstein RR
    The Arabidopsis thaliana ABSCISIC ACID-INSENSITIVE8 encodes a novel protein mediating abscisic acid and sugar responses essential for growth.
    Plant Cell, 2004. 16(2): p. 406-21
    [PMID:14742875]
  26. Seifert GJ,Barber C,Wells B,Roberts K
    Growth regulators and the control of nucleotide sugar flux.
    Plant Cell, 2004. 16(3): p. 723-30
    [PMID:14973160]
  27. Gagne JM, et al.
    Arabidopsis EIN3-binding F-box 1 and 2 form ubiquitin-protein ligases that repress ethylene action and promote growth by directing EIN3 degradation.
    Proc. Natl. Acad. Sci. U.S.A., 2004. 101(17): p. 6803-8
    [PMID:15090654]
  28. Chen G,Alexander L,Grierson D
    Constitutive expression of EIL-like transcription factor partially restores ripening in the ethylene-insensitive Nr tomato mutant.
    J. Exp. Bot., 2004. 55(402): p. 1491-7
    [PMID:15181103]
  29. Klee HJ
    Ethylene signal transduction. Moving beyond Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 660-7
    [PMID:15208412]
  30. Binder BM,Mortimore LA,Stepanova AN,Ecker JR,Bleecker AB
    Short-term growth responses to ethylene in Arabidopsis seedlings are EIN3/EIL1 independent.
    Plant Physiol., 2004. 136(2): p. 2921-7
    [PMID:15466219]
  31. Wubben MJ,Rodermel SR,Baum TJ
    Mutation of a UDP-glucose-4-epimerase alters nematode susceptibility and ethylene responses in Arabidopsis roots.
    Plant J., 2004. 40(5): p. 712-24
    [PMID:15546354]
  32. Wang ZF,Ying TJ
    [Research progress of ethylene signal transduction in plants].
    Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2004. 30(6): p. 601-8
    [PMID:15643078]
  33. Chen YF,Etheridge N,Schaller GE
    Ethylene signal transduction.
    Ann. Bot., 2005. 95(6): p. 901-15
    [PMID:15753119]
  34. Stepanova AN,Alonso JM
    Arabidopsis ethylene signaling pathway.
    Sci. STKE, 2005. 2005(276): p. cm4
    [PMID:15784880]
  35. McGrath KC, et al.
    Repressor- and activator-type ethylene response factors functioning in jasmonate signaling and disease resistance identified via a genome-wide screen of Arabidopsis transcription factor gene expression.
    Plant Physiol., 2005. 139(2): p. 949-59
    [PMID:16183832]
  36. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  37. Babula D, et al.
    Genes involved in biosynthesis and signalisation of ethylene in Brassica oleracea and Arabidopsis thaliana: identification and genome comparative mapping of specific gene homologues.
    Theor. Appl. Genet., 2006. 112(3): p. 410-20
    [PMID:16311726]
  38. Barry CS,Giovannoni JJ
    Ripening in the tomato Green-ripe mutant is inhibited by ectopic expression of a protein that disrupts ethylene signaling.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(20): p. 7923-8
    [PMID:16682641]
  39. Mao C,Wang S,Jia Q,Wu P
    OsEIL1, a rice homolog of the Arabidopsis EIN3 regulates the ethylene response as a positive component.
    Plant Mol. Biol., 2006. 61(1-2): p. 141-52
    [PMID:16786297]
  40. Benavente LM,Alonso JM
    Molecular mechanisms of ethylene signaling in Arabidopsis.
    Mol Biosyst, 2006. 2(3-4): p. 165-73
    [PMID:16880934]
  41. Olmedo G, et al.
    ETHYLENE-INSENSITIVE5 encodes a 5'-->3' exoribonuclease required for regulation of the EIN3-targeting F-box proteins EBF1/2.
    Proc. Natl. Acad. Sci. U.S.A., 2006. 103(36): p. 13286-93
    [PMID:16920797]
  42. Lee JH,Deng XW,Kim WT
    Possible role of light in the maintenance of EIN3/EIL1 stability in Arabidopsis seedlings.
    Biochem. Biophys. Res. Commun., 2006. 350(2): p. 484-91
    [PMID:17011517]
  43. Potuschak T, et al.
    The exoribonuclease XRN4 is a component of the ethylene response pathway in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3047-57
    [PMID:17085683]
  44. Binder BM, et al.
    The Arabidopsis EIN3 binding F-Box proteins EBF1 and EBF2 have distinct but overlapping roles in ethylene signaling.
    Plant Cell, 2007. 19(2): p. 509-23
    [PMID:17307926]
  45. Achard P, et al.
    The plant stress hormone ethylene controls floral transition via DELLA-dependent regulation of floral meristem-identity genes.
    Proc. Natl. Acad. Sci. U.S.A., 2007. 104(15): p. 6484-9
    [PMID:17389366]
  46. Schwager KM, et al.
    Characterization of the VIER F-BOX PROTEINE genes from Arabidopsis reveals their importance for plant growth and development.
    Plant Cell, 2007. 19(4): p. 1163-78
    [PMID:17435085]
  47. Robles LM,Wampole JS,Christians MJ,Larsen PB
    Arabidopsis enhanced ethylene response 4 encodes an EIN3-interacting TFIID transcription factor required for proper ethylene response, including ERF1 induction.
    J. Exp. Bot., 2007. 58(10): p. 2627-39
    [PMID:17526916]
  48. Bouchez O,Huard C,Lorrain S,Roby D,Balagu
    Ethylene is one of the key elements for cell death and defense response control in the Arabidopsis lesion mimic mutant vad1.
    Plant Physiol., 2007. 145(2): p. 465-77
    [PMID:17720753]
  49. Hibi T, et al.
    Involvement of EIN3 homologues in basic PR gene expression and flower development in tobacco plants.
    J. Exp. Bot., 2007. 58(13): p. 3671-8
    [PMID:17965144]
  50. Dugardeyn J,Vandenbussche F,Van Der Straeten D
    To grow or not to grow: what can we learn on ethylene-gibberellin cross-talk by in silico gene expression analysis?
    J. Exp. Bot., 2008. 59(1): p. 1-16
    [PMID:18212030]
  51. Van der Ent S, et al.
    MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis.
    Plant Physiol., 2008. 146(3): p. 1293-304
    [PMID:18218967]
  52. Yoo SD,Cho YH,Tena G,Xiong Y,Sheen J
    Dual control of nuclear EIN3 by bifurcate MAPK cascades in C2H4 signalling.
    Nature, 2008. 451(7180): p. 789-95
    [PMID:18273012]
  53. Mb
    EIN3-like gene expression during fruit ripening of Cavendish banana (Musa acuminata cv. Grande naine).
    Physiol Plant, 2008. 133(2): p. 435-48
    [PMID:18346078]
  54. Christians MJ,Robles LM,Zeller SM,Larsen PB
    The eer5 mutation, which affects a novel proteasome-related subunit, indicates a prominent role for the COP9 signalosome in resetting the ethylene-signaling pathway in Arabidopsis.
    Plant J., 2008. 55(3): p. 467-77
    [PMID:18429939]
  55. Konishi M,Yanagisawa S
    Ethylene signaling in Arabidopsis involves feedback regulation via the elaborate control of EBF2 expression by EIN3.
    Plant J., 2008. 55(5): p. 821-31
    [PMID:18466304]
  56. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  57. Zhu Z,Guo H
    Genetic basis of ethylene perception and signal transduction in Arabidopsis.
    J Integr Plant Biol, 2008. 50(7): p. 808-15
    [PMID:18713391]
  58. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  59. Hahn A,Harter K
    Mitogen-activated protein kinase cascades and ethylene: signaling, biosynthesis, or both?
    Plant Physiol., 2009. 149(3): p. 1207-10
    [PMID:19109412]
  60. Wang X,Kong H,Ma H
    F-box proteins regulate ethylene signaling and more.
    Genes Dev., 2009. 23(4): p. 391-6
    [PMID:19240128]
  61. Cela J,Falk J,Munné-Bosch S
    Ethylene signaling may be involved in the regulation of tocopherol biosynthesis in Arabidopsis thaliana.
    FEBS Lett., 2009. 583(6): p. 992-6
    [PMID:19258016]
  62. Saracco SA, et al.
    Tandem affinity purification and mass spectrometric analysis of ubiquitylated proteins in Arabidopsis.
    Plant J., 2009. 59(2): p. 344-58
    [PMID:19292762]
  63. Yoo SD,Cho Y,Sheen J
    Emerging connections in the ethylene signaling network.
    Trends Plant Sci., 2009. 14(5): p. 270-9
    [PMID:19375376]
  64. Cheng WH,Chiang MH,Hwang SG,Lin PC
    Antagonism between abscisic acid and ethylene in Arabidopsis acts in parallel with the reciprocal regulation of their metabolism and signaling pathways.
    Plant Mol. Biol., 2009. 71(1-2): p. 61-80
    [PMID:19513806]
  65. Abe H, et al.
    Arabidopsis-thrips system for analysis of plant response to insect feeding.
    Plant Signal Behav, 2008. 3(7): p. 446-7
    [PMID:19704479]
  66. Yoo SD,Sheen J
    MAPK signaling in plant hormone ethylene signal transduction.
    Plant Signal Behav, 2008. 3(10): p. 848-9
    [PMID:19704518]
  67. Konishi M,Yanagisawa S
    Two different mechanisms control ethylene sensitivity in Arabidopsis via the regulation of EBF2 expression.
    Plant Signal Behav, 2008. 3(9): p. 749-51
    [PMID:19704846]
  68. Chen H, et al.
    ETHYLENE INSENSITIVE3 and ETHYLENE INSENSITIVE3-LIKE1 repress SALICYLIC ACID INDUCTION DEFICIENT2 expression to negatively regulate plant innate immunity in Arabidopsis.
    Plant Cell, 2009. 21(8): p. 2527-40
    [PMID:19717619]
  69. Zhong S, et al.
    EIN3/EIL1 cooperate with PIF1 to prevent photo-oxidation and to promote greening of Arabidopsis seedlings.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(50): p. 21431-6
    [PMID:19948955]
  70. Camehl I, et al.
    Ethylene signalling and ethylene-targeted transcription factors are required to balance beneficial and nonbeneficial traits in the symbiosis between the endophytic fungus Piriformospora indica and Arabidopsis thaliana.
    New Phytol., 2010. 185(4): p. 1062-73
    [PMID:20085621]
  71. Kagale S,Links MG,Rozwadowski K
    Genome-wide analysis of ethylene-responsive element binding factor-associated amphiphilic repression motif-containing transcriptional regulators in Arabidopsis.
    Plant Physiol., 2010. 152(3): p. 1109-34
    [PMID:20097792]
  72. Garc
    Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis.
    J. Exp. Bot., 2010. 61(14): p. 3885-99
    [PMID:20627899]
  73. An F, et al.
    Ethylene-induced stabilization of ETHYLENE INSENSITIVE3 and EIN3-LIKE1 is mediated by proteasomal degradation of EIN3 binding F-box 1 and 2 that requires EIN2 in Arabidopsis.
    Plant Cell, 2010. 22(7): p. 2384-401
    [PMID:20647342]
  74. Boutrot F, et al.
    Direct transcriptional control of the Arabidopsis immune receptor FLS2 by the ethylene-dependent transcription factors EIN3 and EIL1.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(32): p. 14502-7
    [PMID:20663954]
  75. Adams E,Turner J
    COI1, a jasmonate receptor, is involved in ethylene-induced inhibition of Arabidopsis root growth in the light.
    J. Exp. Bot., 2010. 61(15): p. 4373-86
    [PMID:20699268]
  76. Jeong SW, et al.
    Ethylene suppression of sugar-induced anthocyanin pigmentation in Arabidopsis.
    Plant Physiol., 2010. 154(3): p. 1514-31
    [PMID:20876338]
  77. Liu R, et al.
    Transcription factor AtMYB44 regulates induced expression of the ETHYLENE INSENSITIVE2 gene in Arabidopsis responding to a harpin protein.
    Mol. Plant Microbe Interact., 2011. 24(3): p. 377-89
    [PMID:21117868]
  78. Ellison CT,Vandenbussche F,Van Der Straeten D,Harmer SL
    XAP5 CIRCADIAN TIMEKEEPER regulates ethylene responses in aerial tissues of Arabidopsis.
    Plant Physiol., 2011. 155(2): p. 988-99
    [PMID:21163961]
  79. Bisson MM,Groth G
    New paradigm in ethylene signaling: EIN2, the central regulator of the signaling pathway, interacts directly with the upstream receptors.
    Plant Signal Behav, 2011. 6(1): p. 164-6
    [PMID:21242723]
  80. Skirycz A, et al.
    Pause-and-stop: the effects of osmotic stress on cell proliferation during early leaf development in Arabidopsis and a role for ethylene signaling in cell cycle arrest.
    Plant Cell, 2011. 23(5): p. 1876-88
    [PMID:21558544]
  81. Lingam S, et al.
    Interaction between the bHLH transcription factor FIT and ETHYLENE INSENSITIVE3/ETHYLENE INSENSITIVE3-LIKE1 reveals molecular linkage between the regulation of iron acquisition and ethylene signaling in Arabidopsis.
    Plant Cell, 2011. 23(5): p. 1815-29
    [PMID:21586684]
  82. Lei G, et al.
    EIN2 regulates salt stress response and interacts with a MA3 domain-containing protein ECIP1 in Arabidopsis.
    Plant Cell Environ., 2011. 34(10): p. 1678-92
    [PMID:21631530]
  83. Cela J,Chang C,Munné-Bosch S
    Accumulation of γ- rather than α-tocopherol alters ethylene signaling gene expression in the vte4 mutant of Arabidopsis thaliana.
    Plant Cell Physiol., 2011. 52(8): p. 1389-400
    [PMID:21719428]
  84. Zhu Z, et al.
    Derepression of ethylene-stabilized transcription factors (EIN3/EIL1) mediates jasmonate and ethylene signaling synergy in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2011. 108(30): p. 12539-44
    [PMID:21737749]
  85. Chen SY,Tsai HC,Raghu R,Do YY,Huang PL
    cDNA cloning and functional characterization of ETHYLENE INSENSITIVE 3 orthologs from Oncidium Gower Ramsey involved in flower cutting and pollinia cap dislodgement.
    Plant Physiol. Biochem., 2011. 49(10): p. 1209-19
    [PMID:21775159]
  86. Zhang L, et al.
    An AP2 domain-containing gene, ESE1, targeted by the ethylene signaling component EIN3 is important for the salt response in Arabidopsis.
    Plant Physiol., 2011. 157(2): p. 854-65
    [PMID:21832142]
  87. Laluk K, et al.
    Biochemical and genetic requirements for function of the immune response regulator BOTRYTIS-INDUCED KINASE1 in plant growth, ethylene signaling, and PAMP-triggered immunity in Arabidopsis.
    Plant Cell, 2011. 23(8): p. 2831-49
    [PMID:21862710]
  88. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  89. He W, et al.
    A small-molecule screen identifies L-kynurenine as a competitive inhibitor of TAA1/TAR activity in ethylene-directed auxin biosynthesis and root growth in Arabidopsis.
    Plant Cell, 2011. 23(11): p. 3944-60
    [PMID:22108404]
  90. Zander M,Chen S,Imkampe J,Thurow C,Gatz C
    Repression of the Arabidopsis thaliana jasmonic acid/ethylene-induced defense pathway by TGA-interacting glutaredoxins depends on their C-terminal ALWL motif.
    Mol Plant, 2012. 5(4): p. 831-40
    [PMID:22207719]
  91. Asensi-Fabado MA, et al.
    Enhanced oxidative stress in the ethylene-insensitive (ein3-1) mutant of Arabidopsis thaliana exposed to salt stress.
    J. Plant Physiol., 2012. 169(4): p. 360-8
    [PMID:22209220]
  92. Bauer P,Blondet E
    Transcriptome analysis of ein3 eil1 mutants in response to iron deficiency.
    Plant Signal Behav, 2011. 6(11): p. 1669-71
    [PMID:22212120]
  93. Rojas CM, et al.
    Glycolate oxidase modulates reactive oxygen species-mediated signal transduction during nonhost resistance in Nicotiana benthamiana and Arabidopsis.
    Plant Cell, 2012. 24(1): p. 336-52
    [PMID:22286136]
  94. Nie H, et al.
    SR1, a calmodulin-binding transcription factor, modulates plant defense and ethylene-induced senescence by directly regulating NDR1 and EIN3.
    Plant Physiol., 2012. 158(4): p. 1847-59
    [PMID:22345509]
  95. An F, et al.
    Coordinated regulation of apical hook development by gibberellins and ethylene in etiolated Arabidopsis seedlings.
    Cell Res., 2012. 22(5): p. 915-27
    [PMID:22349459]
  96. Zhao Y, et al.
    Arabidopsis RAP2.2 plays an important role in plant resistance to Botrytis cinerea and ethylene responses.
    New Phytol., 2012. 195(2): p. 450-60
    [PMID:22530619]
  97. Shi Y, et al.
    Ethylene signaling negatively regulates freezing tolerance by repressing expression of CBF and type-A ARR genes in Arabidopsis.
    Plant Cell, 2012. 24(6): p. 2578-95
    [PMID:22706288]
  98. Zhong S, et al.
    A molecular framework of light-controlled phytohormone action in Arabidopsis.
    Curr. Biol., 2012. 22(16): p. 1530-5
    [PMID:22818915]
  99. Liang X, et al.
    Involvement of COP1 in ethylene- and light-regulated hypocotyl elongation.
    Planta, 2012. 236(6): p. 1791-802
    [PMID:22890836]
  100. Qiao H, et al.
    Processing and subcellular trafficking of ER-tethered EIN2 control response to ethylene gas.
    Science, 2012. 338(6105): p. 390-3
    [PMID:22936567]
  101. Kim J,Wilson RL,Case JB,Binder BM
    A comparative study of ethylene growth response kinetics in eudicots and monocots reveals a role for gibberellin in growth inhibition and recovery.
    Plant Physiol., 2012. 160(3): p. 1567-80
    [PMID:22977279]
  102. Zheng D, et al.
    The nitrate transporter NRT2.1 functions in the ethylene response to nitrate deficiency in Arabidopsis.
    Plant Cell Environ., 2013. 36(7): p. 1328-37
    [PMID:23305042]
  103. Chang KN, et al.
    Temporal transcriptional response to ethylene gas drives growth hormone cross-regulation in Arabidopsis.
    Elife, 2013. 2: p. e00675
    [PMID:23795294]
  104. Luo J, et al.
    A DELLA gene, RhGAI1, is a direct target of EIN3 and mediates ethylene-regulated rose petal cell expansion via repressing the expression of RhCesA2.
    J. Exp. Bot., 2013. 64(16): p. 5075-84
    [PMID:24014864]
  105. Li Z,Peng J,Wen X,Guo H
    Ethylene-insensitive3 is a senescence-associated gene that accelerates age-dependent leaf senescence by directly repressing miR164 transcription in Arabidopsis.
    Plant Cell, 2013. 25(9): p. 3311-28
    [PMID:24064769]
  106. Song S, et al.
    Interaction between MYC2 and ETHYLENE INSENSITIVE3 modulates antagonism between jasmonate and ethylene signaling in Arabidopsis.
    Plant Cell, 2014. 26(1): p. 263-79
    [PMID:24399301]
  107. Yang Y, et al.
    The Arabidopsis Mediator subunit MED16 regulates iron homeostasis by associating with EIN3/EIL1 through subunit MED25.
    Plant J., 2014. 77(6): p. 838-51
    [PMID:24456400]
  108. Zhang X, et al.
    Jasmonate-activated MYC2 represses ETHYLENE INSENSITIVE3 activity to antagonize ethylene-promoted apical hook formation in Arabidopsis.
    Plant Cell, 2014. 26(3): p. 1105-17
    [PMID:24668749]
  109. Xie LJ, et al.
    Arabidopsis acyl-CoA-binding protein ACBP3 participates in plant response to hypoxia by modulating very-long-chain fatty acid metabolism.
    Plant J., 2015. 81(1): p. 53-67
    [PMID:25284079]
  110. Peng J, et al.
    Salt-induced stabilization of EIN3/EIL1 confers salinity tolerance by deterring ROS accumulation in Arabidopsis.
    PLoS Genet., 2014. 10(10): p. e1004664
    [PMID:25330213]
  111. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  112. Kang GH,Son S,Cho YH,Yoo SD
    Regulatory role of BOTRYTIS INDUCED KINASE1 in ETHYLENE INSENSITIVE3-dependent gene expression in Arabidopsis.
    Plant Cell Rep., 2015. 34(9): p. 1605-14
    [PMID:26021844]
  113. Sun J,Ma Q,Mao T
    Ethylene Regulates the Arabidopsis Microtubule-Associated Protein WAVE-DAMPENED2-LIKE5 in Etiolated Hypocotyl Elongation.
    Plant Physiol., 2015. 169(1): p. 325-37
    [PMID:26134166]
  114. Qiu K, et al.
    EIN3 and ORE1 Accelerate Degreening during Ethylene-Mediated Leaf Senescence by Directly Activating Chlorophyll Catabolic Genes in Arabidopsis.
    PLoS Genet., 2015. 11(7): p. e1005399
    [PMID:26218222]
  115. Song J, et al.
    Biochemical and Structural Insights into the Mechanism of DNA Recognition by Arabidopsis ETHYLENE INSENSITIVE3.
    PLoS ONE, 2015. 10(9): p. e0137439
    [PMID:26352699]
  116. Roman G,Lubarsky B,Kieber JJ,Rothenberg M,Ecker JR
    Genetic analysis of ethylene signal transduction in Arabidopsis thaliana: five novel mutant loci integrated into a stress response pathway.
    Genetics, 1995. 139(3): p. 1393-409
    [PMID:7768447]
  117. Chao Q, et al.
    Activation of the ethylene gas response pathway in Arabidopsis by the nuclear protein ETHYLENE-INSENSITIVE3 and related proteins.
    Cell, 1997. 89(7): p. 1133-44
    [PMID:9215635]
  118. Woeste K,Kieber JJ
    The molecular basis of ethylene signalling in Arabidopsis.
    Philos. Trans. R. Soc. Lond., B, Biol. Sci., 1998. 353(1374): p. 1431-8
    [PMID:9800206]
  119. Theologis A
    Ethylene signalling: redundant receptors all have their say.
    Curr. Biol., 1998. 8(24): p. R875-8
    [PMID:9843677]
  120. Solano R,Stepanova A,Chao Q,Ecker JR
    Nuclear events in ethylene signaling: a transcriptional cascade mediated by ETHYLENE-INSENSITIVE3 and ETHYLENE-RESPONSE-FACTOR1.
    Genes Dev., 1998. 12(23): p. 3703-14
    [PMID:9851977]